SCOP 1.75: Domain d1wn0b1: 1wn0 B:11-138

Lineage for d1wn0b1 (1wn0 B:11-138)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (6 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins)

6. Protein Histidine-containing phosphotransfer protein HP2 [140411] (1 species)

7. Species Maize (Zea mays) [TaxId:4577] [140412] (1 PDB entry)
   Uniprot Q9SLX1 9-139

8. Domain d1wn0b1: 1wn0 B:11-138 [121071]
   automatically matched to 1WN0 A:9-139

Details for d1wn0b1

PDB Entry: 1wn0, 2.2 Å

PDB Description: Crystal Structure of Histidine-containing Phosphotransfer Protein, ZmHP2, from maize

PDB Compounds: (B:) histidine-containing phosphotransfer protein

SCOP Domain Sequences for d1wn0b1:

Sequence, based on SEQRES records:

>d1wn0b1 a.24.10.2 (B:11-138) Histidine-containing phosphotransfer protein HP2 {Maize (Zea mays) [TaxId: 4577]}
nallssmfasglvdeqfqqlqmlqedggtpgfvaevvtlfcddadriiselaalldqpiv
dfdkvdayvhqlkgssasvgaqkvkftcmqfrqlcqdknrdgcimalavvrnefydlrnk
fqtmlqle

Sequence, based on observed residues (ATOM records):

>d1wn0b1 a.24.10.2 (B:11-138) Histidine-containing phosphotransfer protein HP2 {Maize (Zea mays) [TaxId: 4577]}
nallssmfasglvdeqfqqlqmlqtpgfvaevvtlfcddadriiselaalldqpivdfdk
vdayvhqlkgssasvgaqkvkftcmqfrqlcqdknrdgcimalavvrnefydlrnkfqtm
lqle

Timeline for d1wn0b1:

• d1wn0b1 first appeared in SCOP 1.73
  
• d1wn0b1 is called d1wn0b_ in SCOPe 2.01
  
• d1wn0b1 appears in the current release, SCOPe 2.08, called d1wn0b_