Lineage for d1wlzd1 (1wlz D:229-311)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 769152Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)
  6. 769175Protein DJ-1-binding protein, DJBP [140536] (1 species)
  7. 769176Species Human (Homo sapiens) [TaxId:9606] [140537] (1 PDB entry)
    Uniprot Q5THR3 1160-1242
  8. 769180Domain d1wlzd1: 1wlz D:229-311 [121027]
    automatically matched to 1WLZ A:229-311

Details for d1wlzd1

PDB Entry: 1wlz (more details), 1.6 Å

PDB Description: Crystal structure of DJBP fragment which was obtained by limited proteolysis
PDB Compounds: (D:) CAP-binding protein complex interacting protein 1 isoform a

SCOP Domain Sequences for d1wlzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlzd1 a.39.1.7 (D:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}
atadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqfdr
lwnempvnakgrlkypdflsrfs

SCOP Domain Coordinates for d1wlzd1:

Click to download the PDB-style file with coordinates for d1wlzd1.
(The format of our PDB-style files is described here.)

Timeline for d1wlzd1: