Lineage for d1wlzb_ (1wlz B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 914936Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)
  6. 914997Protein automated matches [190808] (1 species)
    not a true protein
  7. 914998Species Human (Homo sapiens) [TaxId:9606] [188079] (1 PDB entry)
  8. 914999Domain d1wlzb_: 1wlz B: [121025]
    Other proteins in same PDB: d1wlza1
    automated match to d1wlza1

Details for d1wlzb_

PDB Entry: 1wlz (more details), 1.6 Å

PDB Description: Crystal structure of DJBP fragment which was obtained by limited proteolysis
PDB Compounds: (B:) CAP-binding protein complex interacting protein 1 isoform a

SCOPe Domain Sequences for d1wlzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlzb_ a.39.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmatadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqf
drlwnempvnakgrlkypdflsrf

SCOPe Domain Coordinates for d1wlzb_:

Click to download the PDB-style file with coordinates for d1wlzb_.
(The format of our PDB-style files is described here.)

Timeline for d1wlzb_: