Lineage for d1wlve_ (1wlv E:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409951Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1409952Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1410230Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 1410323Protein automated matches [190102] (5 species)
    not a true protein
  7. 1410374Species Thermus thermophilus [TaxId:300852] [186824] (5 PDB entries)
  8. 1410382Domain d1wlve_: 1wlv E: [121020]
    automated match to d1j1ya_
    complexed with act, cl, coa

Details for d1wlve_

PDB Entry: 1wlv (more details), 1.9 Å

PDB Description: Crystal structure of TT0310 protein from Thermus thermophilus HB8
PDB Compounds: (E:) Phenylacetic acid degradation protein paaI

SCOPe Domain Sequences for d1wlve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlve_ d.38.1.5 (E:) automated matches {Thermus thermophilus [TaxId: 300852]}
dpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpav
alscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl

SCOPe Domain Coordinates for d1wlve_:

Click to download the PDB-style file with coordinates for d1wlve_.
(The format of our PDB-style files is described here.)

Timeline for d1wlve_: