SCOP 1.75: Domain d1wg0a1: 1wg0 A:3-230

Lineage for d1wg0a1 (1wg0 A:3-230)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (1 family)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (17 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein 26S proteasome non-ATPase regulatory subunit 10, gankyrin [102881] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102883] (4 PDB entries)

8. Domain d1wg0a1: 1wg0 A:3-230 [120971]
   automatically matched to d1ixva_

Details for d1wg0a1

PDB Entry: 1wg0, 2.53 Å

PDB Description: Structural comparison of Nas6p protein structures in two different crystal forms

PDB Compounds: (A:) Probable 26S proteasome regulatory subunit p28

SCOP Domain Sequences for d1wg0a1:

Sequence; same for both SEQRES and ATOM records:

>d1wg0a1 d.211.1.1 (A:3-230) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmenv
nlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfev
sqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfhal
aeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnvvd

Timeline for d1wg0a1:

• d1wg0a1 first appeared in SCOP 1.73
  
• d1wg0a1 is called d1wg0a_ in SCOPe 2.01
  
• d1wg0a1 appears in the current release, SCOPe 2.08, called d1wg0a2