SCOP 1.73: Domain d1we5f1: 1we5 F:666-772

Lineage for d1we5f1 (1we5 F:666-772)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily)
   sandwich; 10 strands in two sheets

4. Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family)

5. Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein)

6. Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)

7. Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)

8. Domain d1we5f1: 1we5 F:666-772 [120961]
   Other proteins in same PDB: d1we5a2, d1we5a3, d1we5a4, d1we5b2, d1we5b3, d1we5b4, d1we5c2, d1we5c3, d1we5c4, d1we5d2, d1we5d3, d1we5d4, d1we5e2, d1we5e3, d1we5e4, d1we5f2, d1we5f3, d1we5f4
   automatically matched to 2F2H A:666-773
   complexed with mes

Details for d1we5f1

PDB Entry: 1we5, 2.4 Å

PDB Description: crystal structure of alpha-xylosidase from escherichia coli

PDB Compounds: (F:) Putative family 31 glucosidase yicI

SCOP Domain Sequences for d1we5f1:

Sequence; same for both SEQRES and ATOM records:

>d1we5f1 b.150.1.1 (F:666-772) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl

Timeline for d1we5f1:

• d1we5f1 is new in SCOP 1.73
  
• d1we5f1 appears in SCOP 1.75
  
• d1we5f1 appears in the current release, SCOPe 2.08