Lineage for d1we5d1 (1we5 D:666-772)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089028Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 2089029Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) (S)
  5. 2089030Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (3 proteins)
  6. 2089044Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)
  7. 2089045Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)
    Uniprot P31434
  8. 2089073Domain d1we5d1: 1we5 D:666-772 [120953]
    Other proteins in same PDB: d1we5a2, d1we5a3, d1we5a4, d1we5b2, d1we5b3, d1we5b4, d1we5c2, d1we5c3, d1we5c4, d1we5d2, d1we5d3, d1we5d4, d1we5e2, d1we5e3, d1we5e4, d1we5f2, d1we5f3, d1we5f4
    automated match to d2f2ha1
    complexed with mes

Details for d1we5d1

PDB Entry: 1we5 (more details), 2.4 Å

PDB Description: crystal structure of alpha-xylosidase from escherichia coli
PDB Compounds: (D:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1we5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we5d1 b.150.1.1 (D:666-772) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl

SCOPe Domain Coordinates for d1we5d1:

Click to download the PDB-style file with coordinates for d1we5d1.
(The format of our PDB-style files is described here.)

Timeline for d1we5d1: