| Class b: All beta proteins [48724] (177 folds) |
| Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
| Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (4 proteins) Pfam PF16863 |
| Protein Putative glucosidase YicI, N-terminal domain [117140] (1 species) |
| Species Escherichia coli [TaxId:562] [117141] (5 PDB entries) Uniprot P31434 |
| Domain d1we5c2: 1we5 C:1-247 [120950] Other proteins in same PDB: d1we5a1, d1we5a3, d1we5a4, d1we5b1, d1we5b3, d1we5b4, d1we5c1, d1we5c3, d1we5c4, d1we5d1, d1we5d3, d1we5d4, d1we5e1, d1we5e3, d1we5e4, d1we5f1, d1we5f3, d1we5f4 automated match to d2f2ha2 complexed with mes |
PDB Entry: 1we5 (more details), 2.4 Å
SCOPe Domain Sequences for d1we5c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1we5c2 b.30.5.11 (C:1-247) Putative glucosidase YicI, N-terminal domain {Escherichia coli [TaxId: 562]}
mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
vidgptp
Timeline for d1we5c2: