Class b: All beta proteins [48724] (174 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.11: YicI N-terminal domain-like [117139] (2 proteins) |
Protein Putative glucosidase YicI, N-terminal domain [117140] (1 species) |
Species Escherichia coli [TaxId:562] [117141] (5 PDB entries) Uniprot P31434 |
Domain d1we5b2: 1we5 B:1-247 [120946] Other proteins in same PDB: d1we5a1, d1we5a3, d1we5a4, d1we5b1, d1we5b3, d1we5b4, d1we5c1, d1we5c3, d1we5c4, d1we5d1, d1we5d3, d1we5d4, d1we5e1, d1we5e3, d1we5e4, d1we5f1, d1we5f3, d1we5f4 automatically matched to 2F2H A:1-247 complexed with mes |
PDB Entry: 1we5 (more details), 2.4 Å
SCOPe Domain Sequences for d1we5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1we5b2 b.30.5.11 (B:1-247) Putative glucosidase YicI, N-terminal domain {Escherichia coli [TaxId: 562]} mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf vidgptp
Timeline for d1we5b2: