SCOPe 2.06: Domain d1wdpa_: 1wdp A:

Lineage for d1wdpa_ (1wdp A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (25 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [186821] (2 PDB entries)

8. Domain d1wdpa_: 1wdp A: [120907]
   automated match to d1btc__
   complexed with so4

Details for d1wdpa_

PDB Entry: 1wdp, 1.27 Å

PDB Description: The role of an inner loop in the catalytic mechanism of soybean beta-amylase

PDB Compounds: (A:) beta-amylase

SCOPe Domain Sequences for d1wdpa_:

Sequence; same for both SEQRES and ATOM records:

>d1wdpa_ c.1.8.1 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
sdsnmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielk
gpkqydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdif
ytnrsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglg
pagelrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkyndvp
estgffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihww
ykvenhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqel
vqqvlsggwredirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylrls
ddllqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlp
fpwlpetdmkvdg

Timeline for d1wdpa_:

• d1wdpa_ first appeared in SCOP 1.73, called d1wdpa1
  
• d1wdpa_ appears in SCOPe 2.05
  
• d1wdpa_ appears in SCOPe 2.07
  
• d1wdpa_ appears in the current release, SCOPe 2.08