Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein automated matches [190099] (25 species) not a true protein |
Species Soybean (Glycine max) [TaxId:3847] [186821] (2 PDB entries) |
Domain d1wdpa_: 1wdp A: [120907] automated match to d1btc__ complexed with so4 |
PDB Entry: 1wdp (more details), 1.27 Å
SCOPe Domain Sequences for d1wdpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdpa_ c.1.8.1 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]} sdsnmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielk gpkqydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdif ytnrsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglg pagelrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkyndvp estgffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihww ykvenhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqel vqqvlsggwredirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylrls ddllqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlp fpwlpetdmkvdg
Timeline for d1wdpa_: