Lineage for d1wcqc3 (1wcq C:49-404)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674916Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 674917Superfamily b.68.1: Sialidases [50939] (2 families) (S)
  5. 674918Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)
  6. 675018Protein Micromonospora sialidase, N-terminal domain [50946] (1 species)
  7. 675019Species Micromonospora viridifaciens [TaxId:1881] [50947] (8 PDB entries)
  8. 675027Domain d1wcqc3: 1wcq C:49-404 [120902]
    Other proteins in same PDB: d1wcqa1, d1wcqa2, d1wcqb1, d1wcqb2, d1wcqc1, d1wcqc2
    automatically matched to d1eur__
    complexed with dan, gol, na; mutant

Details for d1wcqc3

PDB Entry: 1wcq (more details), 2.1 Å

PDB Description: mutagenesis of the nucleophilic tyrosine in a bacterial sialidase to phenylalanine.
PDB Compounds: (C:) sialidase

SCOP Domain Sequences for d1wcqc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcqc3 b.68.1.1 (C:49-404) Micromonospora sialidase, N-terminal domain {Micromonospora viridifaciens [TaxId: 1881]}
plyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstdgg
rtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpadpn
vlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqytii
naagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkvav
stdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgtir
mscddgqtwpvskvfqpgsmsfstltalpdgtygllyepgtgiryanfnlawlggi

SCOP Domain Coordinates for d1wcqc3:

Click to download the PDB-style file with coordinates for d1wcqc3.
(The format of our PDB-style files is described here.)

Timeline for d1wcqc3: