Class b: All beta proteins [48724] (177 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) |
Protein automated matches [193245] (14 species) not a true protein |
Species Micromonospora viridifaciens [TaxId:1881] [254941] (4 PDB entries) |
Domain d1wcqb3: 1wcq B:47-402 [120899] Other proteins in same PDB: d1wcqa1, d1wcqa2, d1wcqb1, d1wcqb2, d1wcqc1, d1wcqc2 automated match to d1euta3 complexed with dan, gol, na |
PDB Entry: 1wcq (more details), 2.1 Å
SCOPe Domain Sequences for d1wcqb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wcqb3 b.68.1.1 (B:47-402) automated matches {Micromonospora viridifaciens [TaxId: 1881]} geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt irmscddgqtwpvskvfqpgsmsfstltalpdgtygllyepgtgiryanfnlawlg
Timeline for d1wcqb3: