Lineage for d1wcqb3 (1wcq B:47-402)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074740Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2074741Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2074742Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2075035Protein automated matches [193245] (14 species)
    not a true protein
  7. 2075133Species Micromonospora viridifaciens [TaxId:1881] [254941] (4 PDB entries)
  8. 2075142Domain d1wcqb3: 1wcq B:47-402 [120899]
    Other proteins in same PDB: d1wcqa1, d1wcqa2, d1wcqb1, d1wcqb2, d1wcqc1, d1wcqc2
    automated match to d1euta3
    complexed with dan, gol, na

Details for d1wcqb3

PDB Entry: 1wcq (more details), 2.1 Å

PDB Description: mutagenesis of the nucleophilic tyrosine in a bacterial sialidase to phenylalanine.
PDB Compounds: (B:) sialidase

SCOPe Domain Sequences for d1wcqb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcqb3 b.68.1.1 (B:47-402) automated matches {Micromonospora viridifaciens [TaxId: 1881]}
geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
irmscddgqtwpvskvfqpgsmsfstltalpdgtygllyepgtgiryanfnlawlg

SCOPe Domain Coordinates for d1wcqb3:

Click to download the PDB-style file with coordinates for d1wcqb3.
(The format of our PDB-style files is described here.)

Timeline for d1wcqb3: