Lineage for d1wcba1 (1wcb A:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653446Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (40 PDB entries)
  8. 653458Domain d1wcba1: 1wcb A:1-107 [120882]
    Other proteins in same PDB: d1wcba2, d1wcbl2
    automatically matched to d1dqdl1
    complexed with iod, pe1

Details for d1wcba1

PDB Entry: 1wcb (more details), 2.5 Å

PDB Description: plp-dependent catalytic antibody 15a9 in complex with its hapten
PDB Compounds: (A:) fab fragment of catalytic antibody 15a9, light chain

SCOP Domain Sequences for d1wcba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcba1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
dieltqspaimaaspgekvtitcsatsgvnymhwfqqkpgtspklwiystsnlasavpar
fsgsgsgtsysltisrmeaedaatyycqqrstypftfgggtklelk

SCOP Domain Coordinates for d1wcba1:

Click to download the PDB-style file with coordinates for d1wcba1.
(The format of our PDB-style files is described here.)

Timeline for d1wcba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wcba2