SCOPe 2.01: Domain d1wbzc2: 1wbz C:3-180

Lineage for d1wbzc2 (1wbz C:3-180)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (21 PDB entries)

8. Domain d1wbzc2: 1wbz C:3-180 [120876]
   Other proteins in same PDB: d1wbza1, d1wbzb_, d1wbzc1, d1wbzd_
   automatically matched to d1ddha2

Details for d1wbzc2

PDB Entry: 1wbz, 2 Å

PDB Description: crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance

PDB Compounds: (C:) h-2 class I histocompatibility antigen, k-b alpha chain precursor

SCOPe Domain Sequences for d1wbzc2:

Sequence; same for both SEQRES and ATOM records:

>d1wbzc2 d.19.1.1 (C:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeywer
etqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgcd
yialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll

Timeline for d1wbzc2:

• d1wbzc2 first appeared in SCOP 1.73
  
• d1wbzc2 appears in SCOP 1.75
  
• d1wbzc2 appears in SCOPe 2.02
  
• d1wbzc2 appears in the current release, SCOPe 2.08