SCOPe 2.06: Domain d1wbza1: 1wbz A:182-274

Lineage for d1wbza1 (1wbz A:182-274)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (109 PDB entries)
   Uniprot P01901 22-299

8. Domain d1wbza1: 1wbz A:182-274 [120872]
   Other proteins in same PDB: d1wbza2, d1wbzb_, d1wbzc2, d1wbzd_
   automatically matched to d1ddha1

Details for d1wbza1

PDB Entry: 1wbz, 2 Å

PDB Description: crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance

PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain precursor

SCOPe Domain Sequences for d1wbza1:

Sequence; same for both SEQRES and ATOM records:

>d1wbza1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

Timeline for d1wbza1:

• d1wbza1 first appeared in SCOP 1.73
  
• d1wbza1 appears in SCOPe 2.05
  
• d1wbza1 appears in SCOPe 2.07
  
• d1wbza1 appears in the current release, SCOPe 2.08