Lineage for d1wbxb1 (1wbx B:1-99)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654119Protein beta2-microglobulin [88600] (4 species)
  7. 654353Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries)
  8. 654366Domain d1wbxb1: 1wbx B:1-99 [120868]
    Other proteins in same PDB: d1wbxa1, d1wbxa2
    automatically matched to d1bz9b_

Details for d1wbxb1

PDB Entry: 1wbx (more details), 1.9 Å

PDB Description: crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance
PDB Compounds: (B:) beta-2microglobulin

SCOP Domain Sequences for d1wbxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbxb1 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1wbxb1:

Click to download the PDB-style file with coordinates for d1wbxb1.
(The format of our PDB-style files is described here.)

Timeline for d1wbxb1: