Lineage for d1wbxa2 (1wbx A:3-180)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719393Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 719630Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (15 PDB entries)
  8. 719631Domain d1wbxa2: 1wbx A:3-180 [120867]
    Other proteins in same PDB: d1wbxa1, d1wbxb1
    automatically matched to d1ddha2

Details for d1wbxa2

PDB Entry: 1wbx (more details), 1.9 Å

PDB Description: crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOP Domain Sequences for d1wbxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbxa2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

SCOP Domain Coordinates for d1wbxa2:

Click to download the PDB-style file with coordinates for d1wbxa2.
(The format of our PDB-style files is described here.)

Timeline for d1wbxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wbxa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1wbxb1