Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family) |
Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein) |
Protein DNA repair protein MutS, domain II [53152] (2 species) |
Species Escherichia coli [TaxId:562] [53154] (10 PDB entries) |
Domain d1wbda3: 1wbd A:117-269 [120843] Other proteins in same PDB: d1wbda1, d1wbda2, d1wbda4 automatically matched to d1e3ma3 complexed with adp, mg; mutant |
PDB Entry: 1wbd (more details), 2.4 Å
SCOP Domain Sequences for d1wbda3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wbda3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli [TaxId: 562]} gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca agcllqyakdtqrttlphirsitmereqdsiim
Timeline for d1wbda3: