Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species) |
Species Escherichia coli [TaxId:562] [52699] (10 PDB entries) Uniprot P23909 2-800 |
Domain d1wbda2: 1wbd A:567-800 [120842] Other proteins in same PDB: d1wbda1, d1wbda3, d1wbda4 automatically matched to d1e3ma2 protein/DNA complex; complexed with adp, mg; mutant |
PDB Entry: 1wbd (more details), 2.4 Å
SCOPe Domain Sequences for d1wbda2:
Sequence, based on SEQRES records: (download)
>d1wbda2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate yslvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis
>d1wbda2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq talialmayigsyvpaqkveigpidriftrvgfmvemtetanilhnateyslvlmdeigr gtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgdtia fmhsvqdgaasksyglavaalagvpkevikrarqklrelesis
Timeline for d1wbda2: