Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (2 families) automatically mapped to Pfam PF01624 |
Domain d1wbba4: 1wbb A:2-116 [120840] Other proteins in same PDB: d1wbba1, d1wbba2, d1wbba3, d1wbbb1, d1wbbb2, d1wbbb3 automated match to d1w7aa4 protein/DNA complex; complexed with adp, mg; mutant |
PDB Entry: 1wbb (more details), 2.5 Å
SCOPe Domain Sequences for d1wbba4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wbba4 d.75.2.0 (A:2-116) automated matches {Escherichia coli [TaxId: 562]} saienfdahtpmmqqylrlkaqhpeillfyrmgdfyalfyddakrasqlldisltkrgas agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp
Timeline for d1wbba4: