Lineage for d1wbba4 (1wbb A:2-116)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727129Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 727160Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) (S)
  5. 727161Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 727162Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 727163Species Escherichia coli [TaxId:562] [55275] (10 PDB entries)
  8. 727172Domain d1wbba4: 1wbb A:2-116 [120840]
    Other proteins in same PDB: d1wbba1, d1wbba2, d1wbba3
    automatically matched to d1ng9a4
    complexed with adp, mg; mutant

Details for d1wbba4

PDB Entry: 1wbb (more details), 2.5 Å

PDB Description: crystal structure of e. coli dna mismatch repair enzyme muts, e38a mutant, in complex with a g.t mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1wbba4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbba4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
saienfdahtpmmqqylrlkaqhpeillfyrmgdfyalfyddakrasqlldisltkrgas
agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

SCOP Domain Coordinates for d1wbba4:

Click to download the PDB-style file with coordinates for d1wbba4.
(The format of our PDB-style files is described here.)

Timeline for d1wbba4: