Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Escherichia coli [TaxId:562] [226067] (7 PDB entries) |
Domain d1wbba2: 1wbb A:567-800 [120838] Other proteins in same PDB: d1wbba1, d1wbba3, d1wbba4, d1wbbb1, d1wbbb2 automated match to d1wb9a2 protein/DNA complex; complexed with adp, mg; mutant |
PDB Entry: 1wbb (more details), 2.5 Å
SCOPe Domain Sequences for d1wbba2:
Sequence, based on SEQRES records: (download)
>d1wbba2 c.37.1.0 (A:567-800) automated matches {Escherichia coli [TaxId: 562]} ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate yslvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis
>d1wbba2 c.37.1.0 (A:567-800) automated matches {Escherichia coli [TaxId: 562]} ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq talialmayigsyvpaqkveigpidriftrvgfmvemtetanilhnateyslvlmdeigr gtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgdtia fmhsvqdgaasksyglavaalagvpkevikrarqklrelesis
Timeline for d1wbba2: