SCOPe 2.02: Domain d1wb9a4: 1wb9 A:2-116

Lineage for d1wb9a4 (1wb9 A:2-116)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family)

5. Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)

6. Protein DNA repair protein MutS, domain I [55273] (2 species)

7. Species Escherichia coli [TaxId:562] [55275] (10 PDB entries)
   Uniprot P23909 2-800

8. Domain d1wb9a4: 1wb9 A:2-116 [120836]
   Other proteins in same PDB: d1wb9a1, d1wb9a2, d1wb9a3
   automatically matched to d1ng9a4
   protein/DNA complex; complexed with adp, mg; mutant

Details for d1wb9a4

PDB Entry: 1wb9, 2.1 Å

PDB Description: crystal structure of e. coli dna mismatch repair enzyme muts, e38t mutant, in complex with a g.t mismatch

PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1wb9a4:

Sequence; same for both SEQRES and ATOM records:

>d1wb9a4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
saienfdahtpmmqqylrlkaqhpeillfyrmgdfytlfyddakrasqlldisltkrgas
agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

Timeline for d1wb9a4:

• d1wb9a4 first appeared in SCOP 1.73
  
• d1wb9a4 appears in SCOPe 2.01
  
• d1wb9a4 appears in SCOPe 2.03
  
• d1wb9a4 appears in the current release, SCOPe 2.08