Lineage for d1wb9a4 (1wb9 A:2-116)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865422Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 865453Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) (S)
  5. 865454Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 865455Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 865456Species Escherichia coli [TaxId:562] [55275] (10 PDB entries)
    Uniprot P23909 2-800
  8. 865457Domain d1wb9a4: 1wb9 A:2-116 [120836]
    Other proteins in same PDB: d1wb9a1, d1wb9a2, d1wb9a3
    automatically matched to d1ng9a4
    complexed with adp, mg; mutant

Details for d1wb9a4

PDB Entry: 1wb9 (more details), 2.1 Å

PDB Description: crystal structure of e. coli dna mismatch repair enzyme muts, e38t mutant, in complex with a g.t mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1wb9a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb9a4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
saienfdahtpmmqqylrlkaqhpeillfyrmgdfytlfyddakrasqlldisltkrgas
agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

SCOP Domain Coordinates for d1wb9a4:

Click to download the PDB-style file with coordinates for d1wb9a4.
(The format of our PDB-style files is described here.)

Timeline for d1wb9a4: