SCOPe 2.02: Domain d1wb9a3: 1wb9 A:117-269

Lineage for d1wb9a3 (1wb9 A:117-269)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family)

5. Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)

6. Protein DNA repair protein MutS, domain II [53152] (2 species)

7. Species Escherichia coli [TaxId:562] [53154] (10 PDB entries)
   Uniprot P23909 2-800

8. Domain d1wb9a3: 1wb9 A:117-269 [120835]
   Other proteins in same PDB: d1wb9a1, d1wb9a2, d1wb9a4
   automatically matched to d1e3ma3
   protein/DNA complex; complexed with adp, mg; mutant

Details for d1wb9a3

PDB Entry: 1wb9, 2.1 Å

PDB Description: crystal structure of e. coli dna mismatch repair enzyme muts, e38t mutant, in complex with a g.t mismatch

PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1wb9a3:

Sequence; same for both SEQRES and ATOM records:

>d1wb9a3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli [TaxId: 562]}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim

Timeline for d1wb9a3:

• d1wb9a3 first appeared in SCOP 1.73
  
• d1wb9a3 appears in SCOPe 2.01
  
• d1wb9a3 appears in SCOPe 2.03
  
• d1wb9a3 appears in the current release, SCOPe 2.08