SCOP 1.75: Domain d1wb9a2: 1wb9 A:567-800

Lineage for d1wb9a2 (1wb9 A:567-800)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (23 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)

7. Species Escherichia coli [TaxId:562] [52699] (10 PDB entries)
   Uniprot P23909 2-800

8. Domain d1wb9a2: 1wb9 A:567-800 [120834]
   Other proteins in same PDB: d1wb9a1, d1wb9a3, d1wb9a4
   automatically matched to d1e3ma2
   complexed with adp, mg; mutant

Details for d1wb9a2

PDB Entry: 1wb9, 2.1 Å

PDB Description: crystal structure of e. coli dna mismatch repair enzyme muts, e38t mutant, in complex with a g.t mismatch

PDB Compounds: (A:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1wb9a2:

Sequence, based on SEQRES records:

>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate
yslvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh
ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Sequence, based on observed residues (ATOM records):

>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgfmvemtetanilhnateyslvlmdeigr
gtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgdtia
fmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Timeline for d1wb9a2:

• d1wb9a2 first appeared in SCOP 1.73
  
• d1wb9a2 appears in SCOPe 2.01
  
• d1wb9a2 appears in the current release, SCOPe 2.08