SCOPe 2.01: Domain d1wawa2: 1waw A:267-336

Lineage for d1wawa2 (1waw A:267-336)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitotriosidase [82628] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82629] (10 PDB entries)

8. Domain d1wawa2: 1waw A:267-336 [120823]
   Other proteins in same PDB: d1wawa1
   automatically matched to d1hkia2
   complexed with gol, ipa, so4

Details for d1wawa2

PDB Entry: 1waw, 1.75 Å

PDB Description: specificity and affinity of natural product cyclopentapeptide inhibitor argadin against human chitinase

PDB Compounds: (A:) chitotriosidase 1

SCOPe Domain Sequences for d1wawa2:

Sequence; same for both SEQRES and ATOM records:

>d1wawa2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]}
ygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyif
rdnqwvgf

Timeline for d1wawa2:

• d1wawa2 first appeared in SCOP 1.73
  
• d1wawa2 appears in SCOP 1.75
  
• d1wawa2 appears in SCOPe 2.02
  
• d1wawa2 appears in the current release, SCOPe 2.08