Lineage for d1wawa1 (1waw A:22-266,A:337-388)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816441Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 816562Protein Chitotriosidase [82251] (1 species)
  7. 816563Species Human (Homo sapiens) [TaxId:9606] [82252] (10 PDB entries)
  8. 816565Domain d1wawa1: 1waw A:22-266,A:337-388 [120822]
    Other proteins in same PDB: d1wawa2
    automatically matched to d1hkia1
    complexed with gol, ipa, rig, so4

Details for d1wawa1

PDB Entry: 1waw (more details), 1.75 Å

PDB Description: specificity and affinity of natural product cyclopentapeptide inhibitor argadin against human chitinase
PDB Compounds: (A:) chitotriosidase 1

SCOP Domain Sequences for d1wawa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wawa1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]}
aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlqkgtpaskli
lgmptXddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtlrqels

SCOP Domain Coordinates for d1wawa1:

Click to download the PDB-style file with coordinates for d1wawa1.
(The format of our PDB-style files is described here.)

Timeline for d1wawa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wawa2