SCOPe 2.04: Domain d1w8bl_: 1w8b L:

Lineage for d1w8bl_ (1w8b L:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (66 PDB entries)

8. Domain d1w8bl_: 1w8b L: [120717]
   Other proteins in same PDB: d1w8bh_
   automated match to d1klil_
   complexed with 413, ca

Details for d1w8bl_

PDB Entry: 1w8b, 3 Å

PDB Description: factor7 - 413 complex

PDB Compounds: (L:) blood coagulation factor viia

SCOPe Domain Sequences for d1w8bl_:

Sequence; same for both SEQRES and ATOM records:

>d1w8bl_ g.3.11.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilek

Timeline for d1w8bl_:

• d1w8bl_ first appeared in SCOP 1.73, called d1w8bl1
  
• d1w8bl_ was called d1w8bl1 in SCOPe 2.03
  
• d1w8bl_ appears in SCOPe 2.05
  
• d1w8bl_ appears in the current release, SCOPe 2.08