SCOP 1.75: Domain d1w8bl1: 1w8b L:88-143

Lineage for d1w8bl1 (1w8b L:88-143)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (19 PDB entries)
   Uniprot P08709 108-202
   Uniprot P08709 107-202
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d1w8bl1: 1w8b L:88-143 [120717]
   Other proteins in same PDB: d1w8bh1
   automatically matched to d1klil_
   complexed with 413, ca

Details for d1w8bl1

PDB Entry: 1w8b, 3 Å

PDB Description: factor7 - 413 complex

PDB Compounds: (L:) blood coagulation factor viia

SCOP Domain Sequences for d1w8bl1:

Sequence; same for both SEQRES and ATOM records:

>d1w8bl1 g.3.11.1 (L:88-143) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilek

Timeline for d1w8bl1:

• d1w8bl1 first appeared in SCOP 1.73
  
• d1w8bl1 appears in SCOPe 2.01
  
• d1w8bl1 appears in the current release, SCOPe 2.08, called d1w8bl_