![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (22 proteins) |
![]() | Protein Coagulation factor VIIa [57201] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57202] (19 PDB entries) |
![]() | Domain d1w8bl1: 1w8b L:88-143 [120717] Other proteins in same PDB: d1w8bh1 automatically matched to d1klil_ complexed with 413, ca |
PDB Entry: 1w8b (more details), 3 Å
SCOP Domain Sequences for d1w8bl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w8bl1 g.3.11.1 (L:88-143) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} qlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilek
Timeline for d1w8bl1: