Lineage for d1w8bl1 (1w8b L:88-143)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747704Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 747705Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 747714Protein Coagulation factor VIIa [57201] (1 species)
  7. 747715Species Human (Homo sapiens) [TaxId:9606] [57202] (19 PDB entries)
  8. 747729Domain d1w8bl1: 1w8b L:88-143 [120717]
    Other proteins in same PDB: d1w8bh1
    automatically matched to d1klil_
    complexed with 413, ca

Details for d1w8bl1

PDB Entry: 1w8b (more details), 3 Å

PDB Description: factor7 - 413 complex
PDB Compounds: (L:) blood coagulation factor viia

SCOP Domain Sequences for d1w8bl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w8bl1 g.3.11.1 (L:88-143) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilek

SCOP Domain Coordinates for d1w8bl1:

Click to download the PDB-style file with coordinates for d1w8bl1.
(The format of our PDB-style files is described here.)

Timeline for d1w8bl1: