Lineage for d1w7xl1 (1w7x L:90-143)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747704Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 747705Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 747714Protein Coagulation factor VIIa [57201] (1 species)
  7. 747715Species Human (Homo sapiens) [TaxId:9606] [57202] (19 PDB entries)
  8. 747717Domain d1w7xl1: 1w7x L:90-143 [120700]
    Other proteins in same PDB: d1w7xh1
    automatically matched to d1klil_
    complexed with 413, ca, gol, so4

Details for d1w7xl1

PDB Entry: 1w7x (more details), 1.8 Å

PDB Description: factor7 - 413 complex
PDB Compounds: (L:) blood coagulation factor viia

SCOP Domain Sequences for d1w7xl1:

Sequence, based on SEQRES records: (download)

>d1w7xl1 g.3.11.1 (L:90-143) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilek

Sequence, based on observed residues (ATOM records): (download)

>d1w7xl1 g.3.11.1 (L:90-143) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhkrscrchegyslladgvsctptveypcgkipilek

SCOP Domain Coordinates for d1w7xl1:

Click to download the PDB-style file with coordinates for d1w7xl1.
(The format of our PDB-style files is described here.)

Timeline for d1w7xl1: