Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186813] (6 PDB entries) |
Domain d1w7jb_: 1w7j B: [120690] Other proteins in same PDB: d1w7ja1, d1w7ja2 automated match to d1oe9b_ complexed with adp, bef, mg |
PDB Entry: 1w7j (more details), 2 Å
SCOPe Domain Sequences for d1w7jb_:
Sequence, based on SEQRES records: (download)
>d1w7jb_ a.39.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} efkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksrrvdfetf lpmlqavaknrgqgtyedylegfrvfdkegngkvmgaelrhvlttlgekmteeevetvla ghedsngcinyeaflkhil
>d1w7jb_ a.39.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} efkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksrrvdfetf lpmlqavakdylegfrvfdkegngkvmgaelrhvlttlgekmteeevetvlaghedsngc inyeaflkhil
Timeline for d1w7jb_: