SCOP 1.73: Domain d1w7ja1: 1w7j A:5-62

Lineage for d1w7ja1 (1w7j A:5-62)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)

7. Species Chicken (Gallus gallus), Va isoform [TaxId:9031] [101683] (3 PDB entries)

8. Domain d1w7ja1: 1w7j A:5-62 [120688]
   Other proteins in same PDB: d1w7ja2, d1w7jb1
   automatically matched to d1oe9a1
   complexed with adp, bef, mg

Details for d1w7ja1

PDB Entry: 1w7j, 2 Å

PDB Description: crystal structure of myosin v motor with essential light chain + adp-befx - near rigor

PDB Compounds: (A:) myosin va

SCOP Domain Sequences for d1w7ja1:

Sequence; same for both SEQRES and ATOM records:

>d1w7ja1 b.34.3.1 (A:5-62) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]}
elytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelppl

Timeline for d1w7ja1:

• d1w7ja1 is new in SCOP 1.73
  
• d1w7ja1 appears in SCOP 1.75
  
• d1w7ja1 appears in the current release, SCOPe 2.08