SCOP 1.73: Domain d1w6tb2: 1w6t B:1-137

Lineage for d1w6tb2 (1w6t B:1-137)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (7 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [143247] (1 PDB entry)

8. Domain d1w6tb2: 1w6t B:1-137 [120673]
   Other proteins in same PDB: d1w6ta1, d1w6tb1
   automatically matched to 1W6T A:1-137
   complexed with 2pe, mg

Details for d1w6tb2

PDB Entry: 1w6t, 2.1 Å

PDB Description: crystal structure of octameric enolase from streptococcus pneumoniae

PDB Compounds: (B:) enolase

SCOP Domain Sequences for d1w6tb2:

Sequence, based on SEQRES records:

>d1w6tb2 d.54.1.1 (B:1-137) Enolase {Streptococcus pneumoniae [TaxId: 1313]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksryg
glgtqkavdnvnniiaeaiigydvrdqqaidramialdgtpnkgklganailgvsiavar
aaadyleiplysylggf

Sequence, based on observed residues (ATOM records):

>d1w6tb2 d.54.1.1 (B:1-137) Enolase {Streptococcus pneumoniae [TaxId: 1313]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsggeheavelrdgdksrygglg
tqkavdnvnniiaeaiigydvrdqqaidramialdgtpnkgklganailgvsiavaraaa
dyleiplysylggf

Timeline for d1w6tb2:

• d1w6tb2 is new in SCOP 1.73
  
• d1w6tb2 appears in SCOP 1.75
  
• d1w6tb2 appears in the current release, SCOPe 2.08