SCOP 1.73: Domain d1w6tb1: 1w6t B:138-433

Lineage for d1w6tb1 (1w6t B:138-433)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.1: Enolase [51605] (1 protein)

6. Protein Enolase [51606] (7 species)
   Fold of this protein slightly differs from common fold in topology

7. Species Streptococcus pneumoniae [TaxId:1313] [141843] (1 PDB entry)

8. Domain d1w6tb1: 1w6t B:138-433 [120672]
   Other proteins in same PDB: d1w6ta2, d1w6tb2
   automatically matched to 1W6T A:138-433
   complexed with 2pe, mg

Details for d1w6tb1

PDB Entry: 1w6t, 2.1 Å

PDB Description: crystal structure of octameric enolase from streptococcus pneumoniae

PDB Compounds: (B:) enolase

SCOP Domain Sequences for d1w6tb1:

Sequence; same for both SEQRES and ATOM records:

>d1w6tb1 c.1.11.1 (B:138-433) Enolase {Streptococcus pneumoniae [TaxId: 1313]}
ntkvlptpmmniinggshsdapiafqefmilpvgaptfkealrygaeifhalkkilksrg
letavgdeggfaprfegtedgvetilaaieaagyvpgkdvflgfdcassefydkerkvyd
ytkfegegaavrtsaeqidyleelvnkypiitiedgmdendwdgwkalterlgkkvqlvg
ddffvtntdylargiqegaansilikvnqigtltetfeaiemakeagytavvshrsgete
dstiadiavatnagqiktgslsrtdriakynqllriedqlgevaeyrglksfynlk

Timeline for d1w6tb1:

• d1w6tb1 is new in SCOP 1.73
  
• d1w6tb1 appears in SCOP 1.75
  
• d1w6tb1 appears in the current release, SCOPe 2.08