Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
Protein Enolase [51606] (11 species) Fold of this protein slightly differs from common fold in topology |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141843] (1 PDB entry) Uniprot Q8DPS0 138-433 |
Domain d1w6tb1: 1w6t B:138-433 [120672] Other proteins in same PDB: d1w6ta2, d1w6ta3, d1w6tb2, d1w6tb3 automated match to d1w6ta1 complexed with 2pe, mg |
PDB Entry: 1w6t (more details), 2.1 Å
SCOPe Domain Sequences for d1w6tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w6tb1 c.1.11.1 (B:138-433) Enolase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} ntkvlptpmmniinggshsdapiafqefmilpvgaptfkealrygaeifhalkkilksrg letavgdeggfaprfegtedgvetilaaieaagyvpgkdvflgfdcassefydkerkvyd ytkfegegaavrtsaeqidyleelvnkypiitiedgmdendwdgwkalterlgkkvqlvg ddffvtntdylargiqegaansilikvnqigtltetfeaiemakeagytavvshrsgete dstiadiavatnagqiktgslsrtdriakynqllriedqlgevaeyrglksfynlk
Timeline for d1w6tb1: