Lineage for d1w6ta2 (1w6t A:1-137)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860453Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 860454Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 860455Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 860500Protein Enolase [54828] (8 species)
  7. 860551Species Streptococcus pneumoniae [TaxId:1313] [143247] (1 PDB entry)
    Uniprot Q8DPS0 1-137
  8. 860552Domain d1w6ta2: 1w6t A:1-137 [120671]
    Other proteins in same PDB: d1w6ta1, d1w6tb1
    complexed with 2pe, mg

Details for d1w6ta2

PDB Entry: 1w6t (more details), 2.1 Å

PDB Description: crystal structure of octameric enolase from streptococcus pneumoniae
PDB Compounds: (A:) enolase

SCOP Domain Sequences for d1w6ta2:

Sequence, based on SEQRES records: (download)

>d1w6ta2 d.54.1.1 (A:1-137) Enolase {Streptococcus pneumoniae [TaxId: 1313]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksryg
glgtqkavdnvnniiaeaiigydvrdqqaidramialdgtpnkgklganailgvsiavar
aaadyleiplysylggf

Sequence, based on observed residues (ATOM records): (download)

>d1w6ta2 d.54.1.1 (A:1-137) Enolase {Streptococcus pneumoniae [TaxId: 1313]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsggeheavelrdgdksrygglg
tqkavdnvnniiaeaiigydvrdqqaidramialdgtpnkgklganailgvsiavaraaa
dyleiplysylggf

SCOP Domain Coordinates for d1w6ta2:

Click to download the PDB-style file with coordinates for d1w6ta2.
(The format of our PDB-style files is described here.)

Timeline for d1w6ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w6ta1