SCOPe 2.08: Domain d1w60b2: 1w60 B:127-255

Lineage for d1w60b2 (1w60 B:127-255)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254935] (6 PDB entries)

8. Domain d1w60b2: 1w60 B:127-255 [120651]
   automated match to d1plqa2

Details for d1w60b2

PDB Entry: 1w60, 3.15 Å

PDB Description: native human pcna

PDB Compounds: (B:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d1w60b2:

Sequence; same for both SEQRES and ATOM records:

>d1w60b2 d.131.1.0 (B:127-255) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapki

Timeline for d1w60b2:

• d1w60b2 first appeared in SCOP 1.73
  
• d1w60b2 appears in SCOPe 2.07