SCOPe 2.03: Domain d1w5ra1: 1w5r A:3-275

Lineage for d1w5ra1 (1w5r A:3-275)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
   fold similar to that of the factor XIII catalytic domain
   automatically mapped to Pfam PF00797

6. Protein Arylamine N-acetyltransferase [54048] (4 species)

7. Species Mycobacterium smegmatis [TaxId:1772] [75335] (3 PDB entries)

8. Domain d1w5ra1: 1w5r A:3-275 [120643]
   Other proteins in same PDB: d1w5rb_

Details for d1w5ra1

PDB Entry: 1w5r, 1.45 Å

PDB Description: x-ray crystallographic structure of a c70q mycobacterium smegmatis n- arylamine acetyltransferase

PDB Compounds: (A:) arylamine n-acetyltransferase

SCOPe Domain Sequences for d1w5ra1:

Sequence; same for both SEQRES and ATOM records:

>d1w5ra1 d.3.1.5 (A:3-275) Arylamine N-acetyltransferase {Mycobacterium smegmatis [TaxId: 1772]}
mdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfaklv
drrrggyqyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpgadg
rylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytftte
prpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirfdsa
aqvldaivnrfgidlgdlagrdvqarvaevldt

Timeline for d1w5ra1:

• d1w5ra1 first appeared in SCOP 1.73
  
• d1w5ra1 appears in SCOPe 2.02
  
• d1w5ra1 appears in SCOPe 2.04
  
• d1w5ra1 appears in the current release, SCOPe 2.08