Lineage for d1w4ya_ (1w4y A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1093055Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1093056Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1093057Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1093328Protein automated matches [190089] (7 species)
    not a true protein
  7. 1093357Species Horseradish (Armoracia rusticana) [TaxId:3704] [186811] (2 PDB entries)
  8. 1093359Domain d1w4ya_: 1w4y A: [120641]
    automated match to d1gx2a_
    complexed with ca, cmo, hem

Details for d1w4ya_

PDB Entry: 1w4y (more details), 1.6 Å

PDB Description: ferrous horseradish peroxidase c1a in complex with carbon monoxide
PDB Compounds: (A:) horseradish peroxidase c1a

SCOPe Domain Sequences for d1w4ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w4ya_ a.93.1.1 (A:) automated matches {Horseradish (Armoracia rusticana) [TaxId: 3704]}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvns

SCOPe Domain Coordinates for d1w4ya_:

Click to download the PDB-style file with coordinates for d1w4ya_.
(The format of our PDB-style files is described here.)

Timeline for d1w4ya_: