Lineage for d1w4wa_ (1w4w A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720315Protein automated matches [190089] (9 species)
    not a true protein
  7. 2720355Species Horseradish (Armoracia rusticana) [TaxId:3704] [186811] (2 PDB entries)
  8. 2720356Domain d1w4wa_: 1w4w A: [120640]
    automated match to d1gx2a_
    complexed with ca, fmt, hem

Details for d1w4wa_

PDB Entry: 1w4w (more details), 1.55 Å

PDB Description: ferric horseradish peroxidase c1a in complex with formate
PDB Compounds: (A:) horseradish peroxidase c1a

SCOPe Domain Sequences for d1w4wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w4wa_ a.93.1.1 (A:) automated matches {Horseradish (Armoracia rusticana) [TaxId: 3704]}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvns

SCOPe Domain Coordinates for d1w4wa_:

Click to download the PDB-style file with coordinates for d1w4wa_.
(The format of our PDB-style files is described here.)

Timeline for d1w4wa_: