SCOP 1.75: Domain d1w4oa1: 1w4o A:21-124

Lineage for d1w4oa1 (1w4o A:21-124)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (1 family)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (154 PDB entries)

8. Domain d1w4oa1: 1w4o A:21-124 [120633]
   automatically matched to d1rbc__
   complexed with ua3

Details for d1w4oa1

PDB Entry: 1w4o, 1.6 Å

PDB Description: binding of nonnatural 3'-nucleotides to ribonuclease a

PDB Compounds: (A:) Pancreatic Ribonuclease A

SCOP Domain Sequences for d1w4oa1:

Sequence; same for both SEQRES and ATOM records:

>d1w4oa1 d.5.1.1 (A:21-124) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

Timeline for d1w4oa1:

• d1w4oa1 first appeared in SCOP 1.73
  
• d1w4oa1 is called d1w4oa_ in SCOPe 2.01
  
• d1w4oa1 appears in the current release, SCOPe 2.08, called d1w4oa_