SCOPe 2.06: Domain d1w2tc2: 1w2t C:1-294

Lineage for d1w2tc2 (1w2t C:1-294)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.3: Glycosyl hydrolases family 32 N-terminal domain [101884] (3 proteins)
   Pfam PF00251; Glycosyl hydrolase family 32

6. Protein automated matches [254438] (1 species)
   not a true protein
7. Species Thermotoga maritima [TaxId:243274] [254927] (1 PDB entry)

8. Domain d1w2tc2: 1w2t C:1-294 [120612]
   Other proteins in same PDB: d1w2ta1, d1w2tb1, d1w2tc1, d1w2td1, d1w2te1, d1w2tf1
   automated match to d1uypa2
   complexed with cit, so4

Details for d1w2tc2

PDB Entry: 1w2t, 1.87 Å

PDB Description: beta-fructosidase from thermotoga maritima in complex with raffinose

PDB Compounds: (C:) beta fructosidase

SCOPe Domain Sequences for d1w2tc2:

Sequence; same for both SEQRES and ATOM records:

>d1w2tc2 b.67.2.3 (C:1-294) automated matches {Thermotoga maritima [TaxId: 243274]}
lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
fedettkeidcpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkp

Timeline for d1w2tc2:

• d1w2tc2 first appeared in SCOP 1.73
  
• d1w2tc2 appears in SCOPe 2.05
  
• d1w2tc2 appears in SCOPe 2.07
  
• d1w2tc2 appears in the current release, SCOPe 2.08