SCOP 1.73: Domain d1w2ta1: 1w2t A:295-432

Lineage for d1w2ta1 (1w2t A:295-432)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.19: Glycosyl hydrolases family 32 C-terminal domain [101652] (2 proteins)
   Pfam PF08244
   flat sheet beta-sandwich lacking the characteristic beta-bulge in the C-terminal strand

6. Protein Beta-fructosidase (invertase), C-terminal domain [101653] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [101654] (2 PDB entries)

8. Domain d1w2ta1: 1w2t A:295-432 [120607]
   Other proteins in same PDB: d1w2ta2, d1w2tb2, d1w2tc2, d1w2td2, d1w2te2, d1w2tf2
   automatically matched to d1uypa1
   complexed with cit, gla, so4, suc; mutant

Details for d1w2ta1

PDB Entry: 1w2t, 1.87 Å

PDB Description: beta-fructosidase from thermotoga maritima in complex with raffinose

PDB Compounds: (A:) beta fructosidase

SCOP Domain Sequences for d1w2ta1:

Sequence; same for both SEQRES and ATOM records:

>d1w2ta1 b.29.1.19 (A:295-432) Beta-fructosidase (invertase), C-terminal domain {Thermotoga maritima [TaxId: 2336]}
vdellalrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdel
ivdttrsgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynils
vksnqvklevfeleniwl

Timeline for d1w2ta1:

• d1w2ta1 is new in SCOP 1.73
  
• d1w2ta1 appears in SCOP 1.75
  
• d1w2ta1 appears in the current release, SCOPe 2.08