![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) ![]() |
![]() | Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins) |
![]() | Protein Aminopeptidase P [53096] (2 species) synonym: Xaa-Pro dipeptidase, prolidase |
![]() | Species Escherichia coli [TaxId:562] [53097] (26 PDB entries) |
![]() | Domain d1w2mf1: 1w2m F:1-176 [120600] Other proteins in same PDB: d1w2ma2, d1w2mb2, d1w2mc2, d1w2md2, d1w2me2, d1w2mf2 automatically matched to d1a16_1 complexed with ca, cl, ipa |
PDB Entry: 1w2m (more details), 2.4 Å
SCOP Domain Sequences for d1w2mf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2mf1 c.55.2.1 (F:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]} seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk
Timeline for d1w2mf1: