SCOPe 2.01: Domain d1w2kt1: 1w2k T:6-108

Lineage for d1w2kt1 (1w2k T:6-108)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries)

8. Domain d1w2kt1: 1w2k T:6-108 [120588]
   Other proteins in same PDB: d1w2kh1, d1w2kl1, d1w2kl2, d1w2kl3
   automatically matched to d1a21a1
   complexed with 380, bgc, ca, cac, fuc

Details for d1w2kt1

PDB Entry: 1w2k, 3 Å

PDB Description: tf7a_4380 complex

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1w2kt1:

Sequence, based on SEQRES records:

>d1w2kt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpyletnl

Sequence, based on observed residues (ATOM records):

>d1w2kt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tvaaynltwkstnfktilewepkvytvqistksgdwkskcfyttdtecdltdeivkdvkq
tylarvfsypeplyenspeftpyletnl

Timeline for d1w2kt1:

• d1w2kt1 first appeared in SCOP 1.73
  
• d1w2kt1 appears in SCOP 1.75
  
• d1w2kt1 appears in SCOPe 2.02
  
• d1w2kt1 appears in the current release, SCOPe 2.08