SCOPe 2.06: Domain d1w2kl2: 1w2k L:87-142

Lineage for d1w2kl2 (1w2k L:87-142)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (80 PDB entries)

8. Domain d1w2kl2: 1w2k L:87-142 [120586]
   Other proteins in same PDB: d1w2kh_, d1w2kl1, d1w2kl3, d1w2kt1, d1w2kt2
   automated match to d2a2ql2
   complexed with 380, bgc, ca, cac, fuc

Details for d1w2kl2

PDB Entry: 1w2k, 3 Å

PDB Description: tf7a_4380 complex

PDB Compounds: (L:) blood coagulation factor viia

SCOPe Domain Sequences for d1w2kl2:

Sequence; same for both SEQRES and ATOM records:

>d1w2kl2 g.3.11.1 (L:87-142) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

Timeline for d1w2kl2:

• d1w2kl2 first appeared in SCOP 1.73
  
• d1w2kl2 appears in SCOPe 2.05
  
• d1w2kl2 appears in SCOPe 2.07
  
• d1w2kl2 appears in the current release, SCOPe 2.08