Class g: Small proteins [56992] (85 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (22 proteins) |
Protein Factor IX (IXa) [57198] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries) |
Domain d1w2kl2: 1w2k L:91-140 [120586] Other proteins in same PDB: d1w2kh1, d1w2kl3, d1w2kt1, d1w2kt2 automatically matched to d1pfxl2 complexed with 380, bgc, ca, cac, fuc |
PDB Entry: 1w2k (more details), 3 Å
SCOP Domain Sequences for d1w2kl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2kl2 g.3.11.1 (L:91-140) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi
Timeline for d1w2kl2: