Lineage for d1w2kl1 (1w2k L:49-86)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2636580Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2636581Protein automated matches [226968] (4 species)
    not a true protein
  7. 2636582Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries)
  8. 2636606Domain d1w2kl1: 1w2k L:49-86 [120585]
    Other proteins in same PDB: d1w2kh_, d1w2kl2, d1w2kl3, d1w2kt1, d1w2kt2
    automated match to d2a2ql1
    complexed with 380, bgc, ca, cac, fuc

Details for d1w2kl1

PDB Entry: 1w2k (more details), 3 Å

PDB Description: tf7a_4380 complex
PDB Compounds: (L:) blood coagulation factor viia

SCOPe Domain Sequences for d1w2kl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2kl1 g.3.11.0 (L:49-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOPe Domain Coordinates for d1w2kl1:

Click to download the PDB-style file with coordinates for d1w2kl1.
(The format of our PDB-style files is described here.)

Timeline for d1w2kl1: